DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and HSD17B14

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:259 Identity:82/259 - (31%)
Similarity:137/259 - (52%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVGV-LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDV 64
            |:.|. .||||.:|||.|.|||....|.....||:|:..|::....:...|||..  :..:..||
Human     1 MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPG--AVFILCDV 63

  Fly    65 SSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPE----RDYDDVYGVNLKGTFLVTQA 125
            :....|:..|:|.:::|.:. ..|||:||.....   :.||    :.:..:..:||.||:.:|:.
Human    64 TQEDDVKTLVSETIRRFGRL-DCVVNNAGHHPPP---QRPEETSAQGFRQLLELNLLGTYTLTKL 124

  Fly   126 YAKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGY 190
               |:...:...|.::|:||:|..:.......|.|||..|.:.|:..:.:...:|:|||||.||.
Human   125 ---ALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGN 186

  Fly   191 IDTP----MVAVVPD---SVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            |.||    :.|::||   ::::.::.: ||||:|||.|:.....|||| ::::..|..:.||||
Human   187 IWTPLWEELAALMPDPRATIREGMLAQ-PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 80/253 (32%)
BKR_SDR_c 9..248 CDD:187594 78/250 (31%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 82/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.