DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and cbr4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007873.1 Gene:cbr4 / 493259 XenbaseID:XB-GENE-5935857 Length:236 Species:Xenopus tropicalis


Alignment Length:242 Identity:93/242 - (38%)
Similarity:133/242 - (54%) Gaps:12/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQFS 73
            ||..|.|...|||:|..:|||:...||..:.|:|:.|:....|:|:.  .||..|||....:|.:
 Frog     3 KVCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDLEVAKAAAAEVGAH--LALSCDVSKENEIQDT 65

  Fly    74 VAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENG 138
            ..|........ ..:||||||.||..||:....|...:..|||.||....:...::||:|  :.|
 Frog    66 FKEITNNLGNV-DYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQ--QGG 127

  Fly   139 TIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM-VAVVPDS 202
            .|||:.|||....|:||:.|.|:|.|:|.|::..:||..|..||||.:.||:|.|.| :.:..||
 Frog   128 AIVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTLGLEEDS 192

  Fly   203 VKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
            :.:.|    ||||.|.|||:|:.:.||.  :|.|:.|..:.|.|||:
 Frog   193 LTKMV----PLGRFGDPEEVAQSVLFLL--ESPYITGHVLVVDGGLQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 91/239 (38%)
BKR_SDR_c 9..248 CDD:187594 91/239 (38%)
cbr4NP_001007873.1 NADB_Rossmann 3..232 CDD:389744 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.