DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and MGC79752

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:253 Identity:87/253 - (34%)
Similarity:130/253 - (51%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV-----DVS 65
            |..||.|||||.||||..|..|.||.||::....||.:..|||.|  |.|:.:.::.     |::
 Frog    11 LKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQ--GCEQFSGMKPLLVPGDLT 73

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            ..:||:..|.:.:..|.:. .::|||.||...|.:.....:|:|.|..||::..|.:|......:
 Frog    74 DEESVRKIVEQTVAHFGRL-DVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHL 137

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYI--DT 193
            |:.|   |.|||:||:..:.:..|...|..:|:.|...|..|:.|.....:|||.:.||.|  |.
 Frog   138 IQTK---GNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDV 199

  Fly   194 PMVAVVPDSVKQEVVQRC----PLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            ...|.:.:....|.:||.    .|||.|..:|:|:.||||||..:|::.|..:.|.||
 Frog   200 HRRAGLNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 87/253 (34%)
BKR_SDR_c 9..248 CDD:187594 86/250 (34%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.