DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and hsd17b14

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001003521.1 Gene:hsd17b14 / 445127 ZFINID:ZDB-GENE-040801-24 Length:271 Species:Danio rerio


Alignment Length:260 Identity:66/260 - (25%)
Similarity:117/260 - (45%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVI--AVDRNLKAAQETVQELGSERSAA---LEVDVSSAQ 68
            ||.:|||...||||...:...::|:||:  |....:.|.|.....|..|...:   :..|:...:
Zfish    10 KVVIVTGGTRGIGRGIVKTFVQNGSKVVFCAPQTEMSAGQSLESVLNKEGPGSCKFVSCDMREEE 74

  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAG-----ITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAK 128
            .::..:...::.|.|...: ||:.|     .|.|    :....::.|:..:||...||.:: ||.
Zfish    75 DIKQLINVTVESFGQIDCL-VNNVGWHPPHKTTD----ETSGEEFKDLLNLNLISFFLASK-YAL 133

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            ..:.:  ..|.|:||||:||.:.....|.|.|||..:.:.|:..:.:..::.:|||||.|..|.|
Zfish   134 PYLRK--TQGNIINLSSLVASIGQKDAAPYVATKGAITAMTKAMAVDESRYQVRVNCISPSNIMT 196

  Fly   194 PM-----------VAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            |:           .|.:......:::     ||:|...|......|||: .:::..|..:.::||
Zfish   197 PLWEELAANTEDTAATIKGGEDAQLI-----GRMGTEAESGLAALFLAA-DATFCTGIDLFLSGG 255

  Fly   248  247
            Zfish   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 66/260 (25%)
BKR_SDR_c 9..248 CDD:187594 66/260 (25%)
hsd17b14NP_001003521.1 RDH_SDR_c 1..263 CDD:187638 66/260 (25%)
adh_short 26..205 CDD:278532 46/186 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.