DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and F12E12.11

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001040762.2 Gene:F12E12.11 / 4363044 WormBaseID:WBGene00044811 Length:280 Species:Caenorhabditis elegans


Alignment Length:263 Identity:85/263 - (32%)
Similarity:132/263 - (50%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL-----GSERSAALEVDVSS 66
            :||||||||:.:|||||...|.|:.||||....||.:..:||.|.:     .:|...|:..|:::
 Worm     5 SGKVALVTGSSNGIGRAAALLFAQQGAKVTITGRNAERLEETRQAILKSGVPAENVLAIAADLAT 69

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGIT------RDGYLLKMPERDYDDVYGVNLKGTFLVTQA 125
            .|.....:...|:||.:. .|:||:||..      |.|  :.....|:|..:.:|::....:.|.
 Worm    70 DQGQTDLINGTLQKFGRL-DILVNNAGAAVNDPQGRMG--IDQQIEDFDKTFQINMRSVVTLVQK 131

  Fly   126 YAKAMIEQKLENGTIVNLSSIVAKMN-NVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPG 189
            ..:.:|:.|   |.|:|:|||....: ......|..:||.:..||...:....:.|:|||.:.||
 Worm   132 AKEHLIKTK---GEIINVSSIGGGPHAQPDMMYYGMSKAALDQFTRSTAITLIQHGVRVNSVSPG 193

  Fly   190 YIDT---PMVAVVPDSVKQ-----EVVQRC-PLGRLGQPEEIAEVIAFLAS-PQSSYVNGAAIEV 244
            .:.|   ..:...|.::::     |..:.| |.|.:.||.|||:||||||. ..|||:.|.:|..
 Worm   194 GVYTGFGEAMGFPPGALEKIMKYFESHKECVPCGHMAQPIEIAQVIAFLADRTMSSYIIGQSIIA 258

  Fly   245 TGG 247
            .||
 Worm   259 DGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 85/263 (32%)
BKR_SDR_c 9..248 CDD:187594 84/261 (32%)
F12E12.11NP_001040762.2 fabG 3..261 CDD:235975 83/261 (32%)
NADB_Rossmann 4..265 CDD:304358 85/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.