DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and sro

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:209 Identity:48/209 - (22%)
Similarity:88/209 - (42%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALVTGAGSGIGR---------------ATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAA 59
            |.|:||..||:|.               :.|..:..:|||::   :.|.:|::     |..|...
  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLL---QGLASAKD-----GLSRMHT 84

  Fly    60 LEVDVSSAQSVQFSVAEALKKFQQAP----TIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTF 120
            ||:|:....|::....:......:.|    |.::|:||:...|..........:.....||.||.
  Fly    85 LELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTM 149

  Fly   121 LVTQAYAKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNC 185
            .:|......:.:|:   |.|:|::|............|||:||.:..:|:....|..::|:.|..
  Fly   150 RLTHELLPLLRQQQ---GRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVN 211

  Fly   186 ILPG--YIDTPMVA 197
            .:||  .:|:.:.|
  Fly   212 FIPGSFVLDSNIAA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 48/209 (23%)
BKR_SDR_c 9..248 CDD:187594 48/209 (23%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 48/209 (23%)
adh_short 28..229 CDD:278532 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.