DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and naz

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:297 Identity:73/297 - (24%)
Similarity:117/297 - (39%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETV----QELGSERS------------ 57
            ::.:|||..||||....:.||..|.::|...|||:|.:...    :|||....            
  Fly    50 QIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPED 114

  Fly    58 ----AALEVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGI--------TRDGYLLKMPERDYDD 110
                .|..:|:.|.:||.....:.:.:|::. .::||:||:        |.||:     ||... 
  Fly   115 RYFVEARYLDLCSLRSVHHFAGQLMAEFERI-DVLVNNAGVVFANTQMPTEDGF-----ERHSQ- 172

  Fly   111 VYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLSSIV---AKMN-----NVG--------QANYA 159
               ||....||:|......:  |:.|.|.|:.:|:..   ||::     |||        :..:|
  Fly   173 ---VNYLAPFLLTHLLLPHL--QRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFA 232

  Fly   160 ATKAGVISFTEVASKEFGKFGIRVNCILPGYI-------DTPMVAVVPDSVKQEVVQRCPLGRLG 217
            .:|..|:..|...::|.....:.|||..||.:       ::|:::.:  .||........|....
  Fly   233 HSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSL--CVKAVTYPWMWLFMKN 295

  Fly   218 QPEEIAEVIAFLASPQSSYVNG--------AAIEVTG 246
            ..|.....|.....||...|.|        ||..|||
  Fly   296 AYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 73/297 (25%)
BKR_SDR_c 9..248 CDD:187594 73/297 (25%)
nazNP_001287387.1 FabG 47..318 CDD:223959 67/281 (24%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 73/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.