DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG31549

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:248 Identity:77/248 - (31%)
Similarity:119/248 - (47%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL---GSERSAALEVDVSSAQSV 70
            ||.:||||.||||.:....||:.|..::.|.||.:..:||...:   |......|:.|::....|
  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71

  Fly    71 QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKL 135
            |..|...|.|..:. .::||:|||...|.:.......:|.:...|::..:.:|......:::.| 
  Fly    72 QQIVGATLAKHGRI-DVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTK- 134

  Fly   136 ENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYI--DTPMVAV 198
              |.|||:||:.......|...|..:||.|..||...:.|....|:|||.:.||.|  |......
  Fly   135 --GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGG 197

  Fly   199 VPDSVKQEVVQRC----PLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            :.:....:.::.|    .|||.|..:|:|..||||||.|:|:..|.::.|.||
  Fly   198 MDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 77/248 (31%)
BKR_SDR_c 9..248 CDD:187594 77/248 (31%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/248 (31%)
fabG 4..251 CDD:235975 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.