DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and cbr4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_991219.2 Gene:cbr4 / 402954 ZFINID:ZDB-GENE-040426-1796 Length:237 Species:Danio rerio


Alignment Length:241 Identity:92/241 - (38%)
Similarity:130/241 - (53%) Gaps:9/241 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQFS 73
            ::|:|.|...|||||..:|||:.|.:::.:.||.:|||.|.|.|..|....|..|||..:.|| .
Zfish     3 RLAVVFGGSRGIGRAVSKLLAQRGHRIVLLSRNKEAAQATAQSLPGENHLGLSCDVSKEEEVQ-K 66

  Fly    74 VAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENG 138
            ..|.:.|.......:||:|||.||..||:....|...|...||.|:.|..:|..:.|:.   ..|
Zfish    67 AFETINKTCGTVGFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNMLS---HGG 128

  Fly   139 TIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVPDSV 203
            .|||:.|:|....|.||..|:|:|||:..||...:||.....||||.:.||.|.|.|.|.:   .
Zfish   129 AIVNIGSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDMTAGL---A 190

  Fly   204 KQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
            ::..|:..||||.|:|.|:|:.:.||.  :|.|:.|..:.|.|||:
Zfish   191 EEAAVRTIPLGRFGEPAEVAQAVLFLL--ESPYITGQILLVDGGLQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 90/238 (38%)
BKR_SDR_c 9..248 CDD:187594 90/238 (38%)
cbr4NP_991219.2 fabG 1..235 CDD:235546 92/241 (38%)
NADB_Rossmann 3..233 CDD:304358 90/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.