DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and dhrs4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:250 Identity:79/250 - (31%)
Similarity:128/250 - (51%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV-----DVS 65
            |:||||:||.:..|||.|....|.:.||.|:...|......:.|..|   ||..::|     :|.
Zfish    28 LSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVSLL---RSKNIKVIGTTCNVG 89

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            .|:..:..:...:::......:|.|:|.....|.:|...|..:|.:.|||:|.:||:|:.....:
Zfish    90 KAEDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEVWDKILGVNVKASFLLTKMVVPHI 154

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM 195
              :|...|::|.:||:...........|:.:|..::..|...:.|..:..|||||:.||.|.|..
Zfish   155 --EKRGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRF 217

  Fly   196 VAVV--PDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            .:.:  .:.|.:|.:::..:.||||||||..|||||.|.::||:.|..|.||||:
Zfish   218 SSALWENEGVLEEFLKQTSIKRLGQPEEIGGVIAFLCSDEASYITGETITVTGGM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 78/248 (31%)
BKR_SDR_c 9..248 CDD:187594 76/245 (31%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 79/249 (32%)
fabG 28..272 CDD:235975 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.