DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG10672

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:131/252 - (51%) Gaps:16/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV-----DVS 65
            ||||||:||.:..|||.|..:.||.|||.|:...|..|.....:.||   |...|.|     .||
  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAEL---RKLNLNVHGLKCHVS 130

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            ..:..:....|.:.||.:...:|.|:|.....|.:|:..|:.:|.::.||:|.::|:.:.....:
  Fly   131 EPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLL 195

  Fly   131 IEQKLENGTIVNLSSIVA--KMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            .:||  |.:||.:|||..  ....:|.  |:.:|..:|..|:.|:|:....||||||:.||.|.|
  Fly   196 RQQK--NSSIVFVSSIAGYDAFELLGA--YSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256

  Fly   194 PMVAVV--PDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            .....:  .:|..:..:.:.|:||||..||:|.|::||.|..:.|:.|.:|...||:
  Fly   257 KFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 83/250 (33%)
BKR_SDR_c 9..248 CDD:187594 80/247 (32%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/252 (33%)
fabG 67..316 CDD:235975 84/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
43.910

Return to query results.
Submit another query.