DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Cbr4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_872613.1 Gene:Cbr4 / 359725 RGDID:727826 Length:236 Species:Rattus norvegicus


Alignment Length:247 Identity:93/247 - (37%)
Similarity:131/247 - (53%) Gaps:22/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSA-----ALEVDVSSAQ 68
            ||..|.|...|||:|..:|:|:.|.::..|.|||:.|:.|..|||....|     |.|.||    
  Rat     3 KVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDV---- 63

  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133
               .|..|.::|.......:||:|||.||..|::....|.......||.||.|..:|..:.||:|
  Rat    64 ---HSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQ 125

  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAV 198
               .|:|||:.||:....|||||.|:|||.|:|.|:...:||..:..||||.:.||:|.|.|.  
  Rat   126 ---GGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMT-- 185

  Fly   199 VPDSVKQEVVQR-CPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
              ..:|:|..:: .||||.|:..|:|..:.||.  :|.|:.|..:.|.|||:
  Rat   186 --KHLKEEHFKKNIPLGRFGEALEVAHAVVFLL--ESPYITGHVLIVDGGLQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 91/244 (37%)
BKR_SDR_c 9..248 CDD:187594 91/244 (37%)
Cbr4NP_872613.1 NADB_Rossmann 3..232 CDD:419666 91/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.