DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG30491

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:212 Identity:64/212 - (30%)
Similarity:101/212 - (47%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLK----AAQETVQELGSERSAALEVDVSSAQ 68
            |||.:||||.:|||:.|.|.:|:.|..|....||||    |.:|.|.|..::.....:.|::|.:
  Fly    45 GKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQE 109

  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGI-------TRDGYLLKMPERDYDDVYGVNLKGTFLVTQAY 126
            |::..|| |.|:.|:...:::|:||:       |.||..|::         |||..|.||:|...
  Fly   110 SIRHFVA-AFKREQEHLHVLINNAGVMRCPRSLTSDGIELQL---------GVNHMGHFLLTNLL 164

  Fly   127 AKAMIEQKLENGTIVNLSSIVAKMN--NVGQAN----------YAATKAGVISFTEVASKEFGKF 179
            ...:  :|.....|||:||:.....  |.|..|          |:.:|...:.||...:|.....
  Fly   165 LDLL--KKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGT 227

  Fly   180 GIRVNCILPGYIDTPMV 196
            .:..|.:.||.:||.::
  Fly   228 NVTANALHPGVVDTEII 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 64/212 (30%)
BKR_SDR_c 9..248 CDD:187594 63/211 (30%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 64/212 (30%)
NADB_Rossmann 45..319 CDD:304358 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.