DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG6012

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:189 Identity:54/189 - (28%)
Similarity:89/189 - (47%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQF 72
            |..|.||||..|||:...:.|||....|:.:.|..:..|...:|: ::..|.::..:..|...:.
  Fly    49 GDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEI-ADCGAGVQTKIVIADFTKG 112

  Fly    73 S-VAEAL-KKFQQAP-TIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQK 134
            | |.|.: |:....| :|:||:.||.....|||..:.:..::...|:.....:::.:.:.|...|
  Fly   113 SQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASK 177

  Fly   135 LENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            |: |.|||:.|..........|.|||:||...|.|.....|...:||.|..:.|.::.|
  Fly   178 LK-GAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 54/189 (29%)
BKR_SDR_c 9..248 CDD:187594 53/188 (28%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 54/189 (29%)
adh_short 51..243 CDD:278532 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.