DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and firl

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:225 Identity:63/225 - (28%)
Similarity:96/225 - (42%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQE-----LGSERSAALEVDVS 65
            ::|::.|:||.|.||||......|..|:.|:.||.:.|...:||::     ||...|  ...|||
  Fly    53 VSGEIVLITGTGHGIGRELALHYASLGSTVVCVDIDGKNNLQTVEKAKRLNLGEVYS--YSCDVS 115

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            ....|. ::|:.:|......:::||:.||.....:|:....:...|:.||:...|...||:...|
  Fly   116 KRDEVT-ALADRIKSDVGCISVLVNNVGIMPTHPILQQSAEEIQRVFDVNVFSQFWTIQAFLPHM 179

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEF--GKFG--IRVNCILP--- 188
              |:...|.|:.:|||...:.......|.|||..|....|....|.  |.|.  ||...|.|   
  Fly   180 --QEKCRGHIICMSSIAGLVGISNLVPYCATKFAVRGLMEALHAELRQGPFRDLIRTTTIFPYMT 242

  Fly   189 --GYIDTPMV-------AVVPDSVKQEVVQ 209
              |....|.|       .:.|..|.:.:|:
  Fly   243 NTGLCKHPKVKFPSILGLLDPKQVAKRIVE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 63/225 (28%)
BKR_SDR_c 9..248 CDD:187594 62/222 (28%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 56/194 (29%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 62/221 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.