DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG15629

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:226 Identity:60/226 - (26%)
Similarity:103/226 - (45%) Gaps:26/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL---GSERSAALEVDVSSA 67
            ::|:|.|:||.|.|:||......||..|:::..|.|.:|.:.||..|   |.:......||:|..
  Fly    54 ISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAIKTTVDLLAKHGYDNCKGYVVDISDR 118

  Fly    68 QSVQFSVAEALKKFQQAPT-IVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131
            :.:....::..:  :..|. |::|:|||.......::.:|...:.|.:|:...:...:|:...|:
  Fly   119 EQIYQRASQVTE--EVGPVDILINNAGIVCCKPFWELHDRVIQNTYNINIISHYWTVKAFLPHMM 181

  Fly   132 EQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTE---VASKEFGKFGIRVNCILPGYIDT 193
            ..  ..|.||.:.|:...:...|.::|||||...|.|.|   ...|..|...|:::.|.|.||:|
  Fly   182 RN--NRGHIVTVGSVTGMLGTYGCSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINT 244

  Fly   194 PMVA-------------VVPDSVKQEVVQRC 211
            .|.:             .|.|.::..|  ||
  Fly   245 GMFSGVRPRMMPMLEPQYVADRIENAV--RC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 60/226 (27%)
BKR_SDR_c 9..248 CDD:187594 59/223 (26%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.