DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and scu

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster


Alignment Length:256 Identity:85/256 - (33%)
Similarity:132/256 - (51%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQS 69
            ::...|:||||..||:||||...||:.||.||..|.......|..:||| ::...:.|||:|.:.
  Fly     1 MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELG-DKVVFVPVDVTSEKD 64

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAG----ITRDGYLLKMPER--DYDDVYGVNLKGTFLVTQAYAK 128
            |..::..|..||.:. .:.||.||    :....:...:..|  |:..|..:|..|||.|.:..|.
  Fly    65 VSAALQTAKDKFGRL-DLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128

  Fly   129 AM----IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPG 189
            .|    ..|..:.|.|||.:|:.|....:|||.|:|:||.|:..|...:::....|||:..|.||
  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPG 193

  Fly   190 YIDTPMVAVVPDSVKQEVVQRCPL-GRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
            ..:|||:|.:|:.|:..:.:..|. .|||:|.|.|.::.  |..::..:||..|.:.|.|:
  Fly   194 LFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQ--AIYENPLLNGEVIRIDGALR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 84/252 (33%)
BKR_SDR_c 9..248 CDD:187594 84/249 (34%)
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.