DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Mfe2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:123/252 - (48%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVD---------RNLKAAQETVQEL---GSERSAAL 60
            |:||:|||||:|:||....|.|..||||:..|         .:.:||...|.|:   |.|..|..
  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAVADY 76

  Fly    61 EVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQA 125
            ...:..|:.::    .|:|.|.:. .|:||:|||.||..|:|..|:|::.|..|:|||:|..|||
  Fly    77 NSVIDGAKVIE----TAIKAFGRV-DILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQA 136

  Fly   126 YAKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGY 190
            ....|  :|...|.|:..||......|.||.||.|.|.|:|......:.|..:..:..|.|:|..
  Fly   137 AFPYM--KKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTA 199

  Fly   191 IDTPMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .......::||.:..|:          :|:.||.|:|:|.. :|...||:.||...|
  Fly   200 ASRMTEGILPDILFNEL----------KPKLIAPVVAYLCH-ESCEDNGSYIESAAG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 84/252 (33%)
BKR_SDR_c 9..248 CDD:187594 83/251 (33%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 84/252 (33%)
PRK07791 11..248 CDD:236099 84/252 (33%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.