DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG31810

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:202 Identity:59/202 - (29%)
Similarity:93/202 - (46%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALE---VDVSSAQS 69
            |..|:||||..|||:...|.|||.|..::.|.|..:.......|:||:.:..::   .|.:..:.
  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGRE 120

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGITRDGYLL-KMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133
            |...:.:.|...:..  |:||:.|...|...| |:.|....|:..||:....::|:.....||.:
  Fly   121 VYAHIEKELNGIEVG--ILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISR 183

  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAV 198
            :  .|.||||.|......:.....|||||..|..||:....|..:..|.|..::|.::.|.|.: 
  Fly   184 R--KGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNS- 245

  Fly   199 VPDSVKQ 205
            ..|.|:|
  Fly   246 YSDKVRQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 59/202 (29%)
BKR_SDR_c 9..248 CDD:187594 58/201 (29%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 59/202 (29%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 59/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.