Sequence 1: | NP_001259199.1 | Gene: | CG3603 / 31289 | FlyBaseID: | FBgn0029648 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_932349.2 | Gene: | DHRS4L2 / 317749 | HGNCID: | 19731 | Length: | 232 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 60/195 - (30%) |
---|---|---|---|
Similarity: | 93/195 - (47%) | Gaps: | 9/195 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDR---NLKAAQETVQELGSERSAALEVDVSSA 67
Fly 68 QSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIE 132
Fly 133 QKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVA 197
Fly 198 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3603 | NP_001259199.1 | fabG | 6..248 | CDD:235546 | 60/195 (31%) |
BKR_SDR_c | 9..248 | CDD:187594 | 59/192 (31%) | ||
DHRS4L2 | NP_932349.2 | NADB_Rossmann | 24..>210 | CDD:304358 | 57/182 (31%) |
adh_short | 33..210 | CDD:278532 | 56/179 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000019 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X181 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |