DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and spidey

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:248 Identity:62/248 - (25%)
Similarity:113/248 - (45%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSA---ALEVDVSSAQS 69
            |:.|:|||:..|||:|..:.|||.|.|::.:.|:|:......:|:|.:...   .::||.:....
  Fly    52 GEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDE 116

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGIT--RDGYLLKMPERD---YDDVYGVNLKGTFLVTQAYAKA 129
            :...:.|........  ::||:.||:  ...|.|...:.|   ..::...|:.....:|..:...
  Fly   117 IYDKIREKTTGLNVG--VLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPG 179

  Fly   130 MIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTP 194
            ||.|:  .|.|:|:||....:.|...:.|::|||.|..|::....|:.:.||.:..:.||::.|.
  Fly   180 MISQR--RGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATN 242

  Fly   195 MVAVVPDSV---KQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEV 244
            |..:...||   ..|...|..|..||           :|:..:.|:..|.:::
  Fly   243 MSKIRKASVFAPSPETYVRSALSTLG-----------IATQTAGYLPHALLQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 62/248 (25%)
BKR_SDR_c 9..248 CDD:187594 61/247 (25%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 62/248 (25%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.