DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG3842

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:215 Identity:61/215 - (28%)
Similarity:101/215 - (46%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRN---LKAAQETVQELGSERSAAL---EVDVSS 66
            |||.:|||..:|||:.|...||:.||:|....|:   .:||:..:.:  ..|:..|   .:|:.|
  Fly    74 GKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMD--RSRNQQLFNRTLDLGS 136

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGI-------TRDGYLLKMPERDYDDVYGVNLKGTFLVTQ 124
            .|||: :..|..|..:....|::|:||:       |.||         ::..:|||..|.||:|.
  Fly   137 LQSVR-NFVERFKAEESRLDILINNAGVMACPRTLTADG---------FEQQFGVNHLGHFLLTN 191

  Fly   125 AYAKAMIEQKLENGT---IVNLSS---IVAKMNN---VGQAN-------YAATKAGVISFTEVAS 173
                 ::..:|::.:   ||.:||   :..::|.   :.:.|       |:.:|...|.||...|
  Fly   192 -----LLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLS 251

  Fly   174 KEFGKFGIRVNCILPGYIDT 193
            ......|:.|||..||.:.|
  Fly   252 TILKDTGVTVNCCHPGVVRT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 61/215 (28%)
BKR_SDR_c 9..248 CDD:187594 60/214 (28%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 61/215 (28%)
NADB_Rossmann 74..347 CDD:304358 61/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.