DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CG3699

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:249 Identity:83/249 - (33%)
Similarity:139/249 - (55%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVS-SAQS 69
            |:.||.:||||.||||.|..::|||:||.:..|.||:...:.|.:.|...::..:..||: .|.:
  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDADA 67

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQK 134
            :   |.:.|.||.:. .::||:|||...|.|:.:...::|.|...||:|..|:|:|....:::.|
  Fly    68 I---VQQTLAKFGRI-DVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK 128

  Fly   135 LENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM---V 196
               |.:||:||........|..:|..:||.:..||::.:.|....|:|||.:.||::.|.:   :
  Fly   129 ---GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190

  Fly   197 AVVPD---SVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .:|.:   .:.|..:...|:||:|...|:||.:|||||.::|:..||...:.||
  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 83/249 (33%)
BKR_SDR_c 9..248 CDD:187594 82/246 (33%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/247 (33%)
NADB_Rossmann 3..248 CDD:304358 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.