DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Bdh2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001099943.1 Gene:Bdh2 / 295458 RGDID:1309898 Length:255 Species:Rattus norvegicus


Alignment Length:254 Identity:86/254 - (33%)
Similarity:136/254 - (53%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSS 66
            ::|.|.|||.::|.|..|||||:....||:||||||.|.|....||.....|.:...   :||:.
  Rat    10 TMGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYPGIQTRV---LDVTK 71

  Fly    67 AQSV-QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            .:.: ||  |..::|..    ::.|.||....|.:|...|:|:|....:|::..:|:.:|:...|
  Rat    72 KRQIDQF--ASEIEKID----VLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKM 130

  Fly   131 IEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTP 194
            :.||  :|.|:|:||:.:.:..| .:..|:||||.||..|:..:.:|.:.|||.||:.||.:|||
  Rat   131 LAQK--SGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTP 193

  Fly   195 MVAV------VPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .:..      .|....:..:.|...||....||:|.:..:|||.:|:||.|..:.:.||
  Rat   194 SLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESAYVTGTPVVIDGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 85/250 (34%)
BKR_SDR_c 9..248 CDD:187594 83/247 (34%)
Bdh2NP_001099943.1 PRK06138 12..254 CDD:235712 86/252 (34%)
DHRS6_like_SDR_c 15..255 CDD:187626 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.