DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Dhrs4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_695227.2 Gene:Dhrs4 / 266686 RGDID:708482 Length:279 Species:Rattus norvegicus


Alignment Length:246 Identity:77/246 - (31%)
Similarity:124/246 - (50%) Gaps:6/246 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV--DVSSAQ 68
            ||.||||||.:..|||.|..|.||.|||.|:...|..:.....|..|..|..:...|  .|..|:
  Rat    31 LANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGEGLSVTGVVCHVGKAE 95

  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133
            ..:..|..|||..|....:|.|:|.....|.|:.:.|..::.|..:|:..:.::.:|...||  :
  Rat    96 DREKLVNMALKLHQGIDILVSNAAVNPFFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAM--E 158

  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAV 198
            |...|::|.:||:...:.......|..:|..::..|:..:.|.....|||||:.||.|.|...:|
  Rat   159 KRGGGSVVIVSSVAGFVLFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHFSSV 223

  Fly   199 V-PDSVKQEVV-QRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            : .:..::|:: :...:.|||:||:...:::||.|..:||:||..:.|.||
  Rat   224 LWKEKAREEMIKETMQIRRLGKPEDCVGIVSFLCSEDASYINGETVVVGGG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 77/246 (31%)
BKR_SDR_c 9..248 CDD:187594 75/243 (31%)
Dhrs4NP_695227.2 CR_SDR_c 24..279 CDD:187641 77/246 (31%)
Microbody targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.