DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Decr2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036063.1 Gene:Decr2 / 26378 MGIID:1347059 Length:292 Species:Mus musculus


Alignment Length:254 Identity:80/254 - (31%)
Similarity:122/254 - (48%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLK----AAQETVQELGSERSAALEVDVS 65
            :|..|||.:||.|||||.....:..|.|...:.|.|:|:    ||::.|...| :|...|.:||.
Mouse    25 LLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATG-KRCLPLSMDVR 88

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLL----KMPERDYDDVYGVNLKGTFLVTQAY 126
            ....|..:|.:||::|.:. .|::|.|.    |..|    .:....:..|..::..|||.|:...
Mouse    89 VPPEVMTAVDQALQEFGKI-NILINCAA----GNFLCPASALSFNAFKTVVDIDTIGTFNVSSVL 148

  Fly   127 AKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYI 191
            .|.....  ..|.|||:::.::....|.|.:..|.||.|.:.|...:.|:|...||||.:.||.|
Mouse   149 YKKFFRD--HGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAI 211

  Fly   192 D-TPMVAVVPDSVKQEVVQRC--PLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            . |..:..:..|.....::..  |:.|||...|||..:.:||||.:|||:|..:.|.||
Mouse   212 SGTEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 80/253 (32%)
BKR_SDR_c 9..248 CDD:187594 79/250 (32%)
Decr2NP_036063.1 TER_DECR_SDR_a 26..273 CDD:187627 80/253 (32%)
PRK07576 26..271 CDD:236056 80/253 (32%)
Substrate binding. /evidence=ECO:0000250 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.