DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and DECR2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_065715.1 Gene:DECR2 / 26063 HGNCID:2754 Length:292 Species:Homo sapiens


Alignment Length:262 Identity:82/262 - (31%)
Similarity:120/262 - (45%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELG---SERSAALEVDVSS 66
            :|..|||.:||.|||||.....:..|.|...:...|:|.......::|.   ..|...|.:||.:
Human    25 LLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRA 89

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLL---KMPERDYDDVYGVNLKGTFLVTQA-YA 127
            ..:|..:|.:|||:|.:...::..:||    .:|.   .:....:..|..::..|||.|::. |.
Human    90 PPAVMAAVDQALKEFGRIDILINCAAG----NFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYE 150

  Fly   128 KAMIEQKLENGTIVNLSSIVAKMNNVGQA---NYAATKAGVISFTEVASKEFGKFGIRVNCILPG 189
            |...:   ..|.|||   |.|.:.|.|||   :..:.||.|.:.|...:.|:|...||||.:.||
Human   151 KFFRD---HGGVIVN---ITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPG 209

  Fly   190 YID---------TPMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVT 245
            .|.         .|..::   |.|   |...||.|||...|||..:.:||||.:|||.||.:...
Human   210 PISGTEGLRRLGGPQASL---STK---VTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVAD 268

  Fly   246 GG 247
            ||
Human   269 GG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 82/261 (31%)
BKR_SDR_c 9..248 CDD:187594 81/258 (31%)
DECR2NP_065715.1 TER_DECR_SDR_a 26..273 CDD:187627 82/261 (31%)
Substrate binding 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.