DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and SPAC922.06

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 / 2543550 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:246 Identity:75/246 - (30%)
Similarity:130/246 - (52%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQF 72
            |:|.|:|||..|||:..|::....|.:|..:|   ......||    :.:.||:.|||.|..::.
pombe     5 GRVVLITGAAGGIGKVLCKMFTELGDRVAGID---IVDPSKVQ----DAALALQADVSKADQIET 62

  Fly    73 SVAEALKKFQQAP-TIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLE 136
            ::.:.::..  .| .:::|:||:..|....::....:|....:.|:|.:| ||.|....:.::.:
pombe    63 AIEKVIQTL--GPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYL-TQRYVIPHMAKQGK 124

  Fly   137 NGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTP----MVA 197
            .|:|||:.|:...: .:|...|:|.|||:.:.|:..:..:|..|||||...||.|.:|    ...
pombe   125 GGSIVNIGSVNGHI-YLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPAWDERFK 188

  Fly   198 VVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            ..|| |...:.:..|:||||.||::|..:.|||..::|::.|..:.|.|||
pombe   189 KHPD-VGDRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGGL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 73/244 (30%)
BKR_SDR_c 9..248 CDD:187594 72/243 (30%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 74/245 (30%)
SDR_c 8..235 CDD:212491 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.