DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and oar2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 / 2543512 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:72/244 - (29%)
Similarity:126/244 - (51%) Gaps:19/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQFSVAE 76
            |:||..||:|:...::.::.|.:...|.||....:||:|.|...:.....:.::..||..    :
pombe     5 LITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADVQSDM----K 65

  Fly    77 ALKKFQQAPTI--VVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIE-----QK 134
            .||...::..|  ||::||:.:....::..|::.|.:...||.....:::   .|::|     ..
pombe    66 NLKSIFESVEIDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSK---MAILEWFRNKNS 127

  Fly   135 LENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVV 199
            ..:..|:|:||.::.....|.:.|||:|||:.|||:|.:.|....|||||.|.|||:||||::  
pombe   128 ERDRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPMLS-- 190

  Fly   200 PDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
             ..::....::.|:|||...:||.:...||.  .:.|..|..:.:||||
pombe   191 -SQIRAIAEKKVPIGRLASTDEIVDACTFLL--DNRYTTGTILPITGGL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 70/242 (29%)
BKR_SDR_c 9..248 CDD:187594 70/242 (29%)
oar2NP_594074.1 FabG 1..236 CDD:223959 70/242 (29%)
SDR_c 4..233 CDD:212491 68/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.