DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:73/249 - (29%)
Similarity:121/249 - (48%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKV-IAVDRNLKAAQETVQELGSE---RSAALEVDVSS 66
            |.||..|:||...|||.:..:..|..|:.| :...|| |.|.|...||..:   ::.|....:.:
pombe     7 LKGKTTLITGGSGGIGFSIAKAFAAAGSNVGLLYGRN-KKALEYAAELRDKHGVQAKAYSCPIEN 70

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERD-YDDVYGVNLKGTFLVTQAYAKAM 130
            ..:|..:..:|:::......:::.:|||......|:....| :..|.|:||.|.:...||.....
pombe    71 RSAVIETTNQAVEELGGRLDVMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHF 135

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQ--ANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
              :|...|:::..:|:...:.|..|  |:|.||||.|.......:.|:..|. |||.:.||||||
pombe   136 --KKQGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEWAPFA-RVNSVSPGYIDT 197

  Fly   194 PMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .:.....::::::..:..|..|:|.|:|:.....:|||..|||..|:.|.|.||
pombe   198 DLTLYADENLRKKWKEYTPQARIGLPDELPGAYLYLASDASSYCTGSDIIVDGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 73/249 (29%)
BKR_SDR_c 9..248 CDD:187594 71/246 (29%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 73/249 (29%)
MDH-like_SDR_c 2..254 CDD:187610 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.