DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and SPBC30D10.05c

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_596280.1 Gene:SPBC30D10.05c / 2540402 PomBaseID:SPBC30D10.05c Length:247 Species:Schizosaccharomyces pombe


Alignment Length:250 Identity:72/250 - (28%)
Similarity:122/250 - (48%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQ 71
            |.||.|:||:..|||.||...|.:. ||||||.|:|....||:.....:....::.||:..... 
pombe     5 AEKVILLTGSSKGIGLATAEALQKK-AKVIAVSRSLTPELETLLIQNPDSFVHVKGDVTEVGKA- 67

  Fly    72 FSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDD---VYGVNLKGTFLVTQAYAKAMIEQ 133
             |:..|:|||.:..::::| ||:...  :.|:.:.|.::   ::.:|.   |.|.:....|:...
pombe    68 -SIETAIKKFGKLDSVILN-AGVLEP--IAKIADADINEWRKLFDINF---FSVVETVKYAIPHL 125

  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGV-ISFTEVASKEFGKFGIRVNCILPGYIDTPM-V 196
            :...||||.:||..|.......|.|..:||.: :....:.|:|.....:.|.   ||.:|||| |
pombe   126 RKTKGTIVIVSSGAAVRVFPAWAAYCCSKAAINMLVMNLGSEEPDIMSVAVR---PGVVDTPMQV 187

  Fly   197 AVVPDSVKQEV--------VQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIE 243
            ::..||.|:.:        .:....|:|..|::||:.::|||...:..:.|..:|
pombe   188 SIRNDSNKEAMGGDTHNFFKELKTSGQLVAPQDIAKALSFLALNNNPKLTGQFVE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 71/249 (29%)
BKR_SDR_c 9..248 CDD:187594 70/247 (28%)
SPBC30D10.05cNP_596280.1 adh_short 7..190 CDD:278532 58/194 (30%)
SPR-like_SDR_c 8..245 CDD:187625 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.