DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and SPCC1739.08c

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_588416.1 Gene:SPCC1739.08c / 2539211 PomBaseID:SPCC1739.08c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:251 Identity:75/251 - (29%)
Similarity:119/251 - (47%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVI-------AVDRNLKAAQETVQELGSERSAALEVD 63
            |.||..:|.||..|||.:.....|:.|..||       ..::..|.|:||..::.:     |::|
pombe    19 LKGKNCVVFGAAKGIGFSIATAFAQAGGNVIITYLTTDPTEKAKKLAEETGVQVHT-----LKID 78

  Fly    64 VSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAK 128
            :|.:.:|:..|.|..|.|::...:|.| ||:.....:|..|..:::.|..:|....:.|  ||..
pombe    79 ISRSDTVEAGVEEIQKIFKEIHVVVAN-AGMPFRRSVLDSPPHEFEKVMNINTNSVYRV--AYYM 140

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQ--ANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYI 191
            ..|.:|...|.::..:|:.|.:.|..|  |.|.|:||.|....:..:.|:.:|. |:|.:.|||.
pombe   141 GKIFKKQGFGNLIATASMSATIVNAPQHIAAYCASKAAVRQLCKALAVEWAEFA-RINSVSPGYF 204

  Fly   192 DTPMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .|.|...  :.:|| .....|..|||...|:.....:|||..||:|.|..:.|.||
pombe   205 ATDMPGY--EFLKQ-WEPYVPFKRLGLTPELRGTYLYLASNASSFVTGLDLIVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 75/251 (30%)
BKR_SDR_c 9..248 CDD:187594 73/248 (29%)
SPCC1739.08cNP_588416.1 PRK05867 13..260 CDD:135631 75/251 (30%)
MDH-like_SDR_c 14..260 CDD:187610 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.