DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and ZK829.1

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_502263.1 Gene:ZK829.1 / 191434 WormBaseID:WBGene00014093 Length:284 Species:Caenorhabditis elegans


Alignment Length:265 Identity:72/265 - (27%)
Similarity:129/265 - (48%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQET---VQELGSERSAALEV--DVSS 66
            :|||.|::|:..|||:||....|.:|||::...|:....::|   ..|:|::....|..  |:::
 Worm     7 SGKVVLISGSSKGIGQATAVKFAAEGAKIVLNGRSADDVEKTRKLCMEVGAKPWDLLPTVGDITN 71

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGIT------RDGYLLKMPERDYDDVYGVNLKGTFLVTQA 125
            ...|:..|...:..|.:. .|::|:||..      ::|:  :|.....|..:..|.|...::|||
 Worm    72 EDFVKMMVNTVIHNFGKL-DILINNAGTLEVDMTGKEGW--EMGVDVMDRSWNSNFKSVLMLTQA 133

  Fly   126 YAKAMIEQKLENGTIVNLSSIVAK--MNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILP 188
            ....:|:.|   |.|||:|:.::.  :..:....||..||.:...:...:.|:...|:|:|.:.|
 Worm   134 AMPHLIKTK---GDIVNVSTFLSSGPIGVMSMPYYAVPKAALDQMSRSMAHEYMLKGVRLNTVNP 195

  Fly   189 GYIDTPMVAVVP----------DSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQ-SSYVNGAAI 242
            |.:.|...|.:|          ::..|...:..||||:.|..::||.|.|||..: |..:.|.:|
 Worm   196 GLVSTSFFARLPGVGDDNARKMENYVQSKTEYIPLGRVCQASDVAETILFLADRKVSECIVGQSI 260

  Fly   243 EVTGG 247
            .:.||
 Worm   261 IIDGG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 72/265 (27%)
BKR_SDR_c 9..248 CDD:187594 71/263 (27%)
ZK829.1NP_502263.1 FabG 5..265 CDD:223959 70/263 (27%)
NADB_Rossmann 6..268 CDD:304358 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.