DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and W03F9.9

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503143.1 Gene:W03F9.9 / 189164 WormBaseID:WBGene00021003 Length:280 Species:Caenorhabditis elegans


Alignment Length:272 Identity:93/272 - (34%)
Similarity:133/272 - (48%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL-------GSERSAALEVDVSS 66
            :||:|||:.:||||||..|||.:||||....||.:..:|:.|.|       |...|...:|...:
 Worm     8 EVAIVTGSSNGIGRATAILLASEGAKVTITGRNAERLEESRQALLKVGVPSGHINSVVADVTTGA 72

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVT-QAYAKAM 130
            .|.|  .:...||||.:. .|::|:||.     |:..||...:...||.   |.|.| |...:::
 Worm    73 GQDV--LIDSTLKKFGKI-NILINNAGA-----LIVDPEGKTNTSTGVE---TCLKTFQLNFQSV 126

  Fly   131 IE--QKLE------NGTIVNLSSIVAKMNNVGQA------NYAATKAGVISFTEVASKEFGKFGI 181
            :|  ||:.      :|.|||:||:.|     |.|      .|:|.||.:..::...:.:....||
 Worm   127 VEMTQKIRPHLANTHGEIVNVSSVGA-----GPAAENRFPYYSAAKAALDQYSRNTAIDLIPDGI 186

  Fly   182 RVNCILPGYIDTPMVAVV----PD-SVKQ-EVV---QRC-PLGRLGQPEEIAEVIAFLASPQSS- 235
            |||.:.||::.|......    || |.|. |.:   ..| |.|..|:||.:|.||||||..::| 
 Worm   187 RVNIVQPGFVATGFTTAASGMSPDASAKMYEGIGANTSCIPAGYCGRPEHLASVIAFLADRKASE 251

  Fly   236 YVNGAAIEVTGG 247
            |:.|..|...||
 Worm   252 YIVGQTIIADGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 93/272 (34%)
BKR_SDR_c 9..248 CDD:187594 93/272 (34%)
W03F9.9NP_503143.1 FabG 4..263 CDD:223959 91/270 (34%)
NADB_Rossmann 5..267 CDD:304358 93/272 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.