DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and decr-1.2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_495805.1 Gene:decr-1.2 / 189090 WormBaseID:WBGene00012177 Length:309 Species:Caenorhabditis elegans


Alignment Length:259 Identity:79/259 - (30%)
Similarity:128/259 - (49%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALE---VDVS 65
            |...||:.||||.|:|||:|.....|...|.|:...|.::..::|.:::........|   :|:.
 Worm    21 GAFKGKLVLVTGGGTGIGKAIATTFAHLRATVVIAARRMEKLEQTARDITKITGGTCEPFQMDIK 85

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYG----VNLKGTFLVTQAY 126
            ....|..:..:...||.:.|.|:||:|.    |..:...|....:.||    :.|||||.||...
 Worm    86 DPGMVSDAFDKIDMKFGKVPEILVNNAA----GNFIMATELLSSNAYGTIIDIVLKGTFNVTTEL 146

  Fly   127 AKAMIEQKLENGTIVNLSSIVAKMNNVGQ---ANYAATKAGVISFTEVASKEFGKFGIRVNCILP 188
            .|..|:.|    |..:::||.|.....|.   ...|.:||||.:.|:..:.|:.|:|:|.|.:.|
 Worm   147 GKRCIQNK----TGASITSITAGYARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSP 207

  Fly   189 GYIDTP-----MVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            |.|.|.     :.:.....:.:::....|.||:|.|||:|.::||::|...|::|||.|::.||
 Worm   208 GPIPTKGAWGRLNSGEMGDIAEKMKFLNPEGRVGSPEEVANLVAFISSDHMSFLNGAIIDLDGG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 78/257 (30%)
BKR_SDR_c 9..248 CDD:187594 77/254 (30%)
decr-1.2NP_495805.1 TER_DECR_SDR_a 23..274 CDD:187627 78/257 (30%)
PRK07677 25..272 CDD:181077 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.