DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and R05D8.9

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:266 Identity:89/266 - (33%)
Similarity:140/266 - (52%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL---GSERSAALEV--DVSS 66
            :||||||||:.:|||||...|.|:|||||....||.:..:||.||:   |...|..|.|  |:::
 Worm     6 SGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSVATDLAA 70

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGIT------RDGYLLKMPERD---YDDVYGVNLKGTFLV 122
            .:.....|...::||.:. .|:||:||..      |.|.     ::|   ||.:..:|::....:
 Worm    71 EKGQDELVNSTIQKFGRL-DILVNNAGAAFNDDQGRVGV-----DQDVSVYDKIMQINMRSVVTL 129

  Fly   123 TQAYAKAMIEQKLENGTIVNLSSIVAKMN-NVGQANYAATKAGVISFTEVASKEFGKFGIRVNCI 186
            ||...:.:::.|   |.|||:|||....: ..|...||.:|:.:..||..|:.:..::|:|||.:
 Worm   130 TQKAKEHLVKAK---GEIVNVSSIAGTAHAQPGVMYYAMSKSALDQFTRCAAIDLIQYGVRVNSV 191

  Fly   187 LPGYIDTPM--VAVVPDSVKQEVV------QRC-PLGRLGQPEEIAEVIAFLASPQ-SSYVNGAA 241
            .||.:.|..  ...:|....:|::      :.| |.|.:.:|.:||.:|||||..: |||:.|.:
 Worm   192 SPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPIDIANIIAFLADRKLSSYIIGQS 256

  Fly   242 IEVTGG 247
            |...||
 Worm   257 IVADGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 89/266 (33%)
BKR_SDR_c 9..248 CDD:187594 88/264 (33%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 89/266 (33%)
NADB_Rossmann 5..266 CDD:304358 89/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.