DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and F26D2.15

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_507157.1 Gene:F26D2.15 / 184969 WormBaseID:WBGene00009153 Length:279 Species:Caenorhabditis elegans


Alignment Length:260 Identity:79/260 - (30%)
Similarity:129/260 - (49%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQE-----LGSERSAALEVDVSS 66
            :|||||:||:.:|||||...|.|:.||||....||.:..:||..|     :.:|...|:..||.:
 Worm     5 SGKVALITGSSNGIGRAAAILFAQQGAKVTITGRNAERLKETRHEIKKSGIPAENILAIVADVIT 69

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERD---YDDVYGVNLKGTFLVTQAYAK 128
            .:.....:.:.::||.....:|.|:.|...|.......::|   :|:...:|::....:.|...:
 Worm    70 DEGQMRLINDTVRKFGHLDILVNNAGGALMDAQGRVGMDQDISVFDNTMQINMRSVVTLVQKAKE 134

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQAN-YAATKAGVISFTEVASKEFGKFGIRVNCILPGYID 192
            .:|:.|   |.|:|:|::.|..:....|. |..:||.:..||..::....:.|:|||.:.||:..
 Worm   135 HLIKSK---GEIINVSAMAAGHHGDPIATFYGMSKAALDQFTRSSAISLIQHGVRVNSVSPGFTK 196

  Fly   193 T--------PMVAVVPDSVKQEVVQRC-PLGRLGQPEEIAEVIAFLAS-PQSSYVNGAAIEVTGG 247
            |        |.:|:.......|..:.| |.|.:.||.:||:||.|||. ..|||:.|.:|...||
 Worm   197 TGFGEAMGFPPIAMKKVISFYESHKECAPSGAIAQPGDIAQVILFLADRTMSSYIIGQSIIADGG 261

  Fly   248  247
             Worm   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 79/260 (30%)
BKR_SDR_c 9..248 CDD:187594 78/258 (30%)
F26D2.15NP_507157.1 fabG 3..265 CDD:235975 79/260 (30%)
NADB_Rossmann 4..265 CDD:304358 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.