DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and dhrs-4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_506230.1 Gene:dhrs-4 / 179772 WormBaseID:WBGene00010063 Length:260 Species:Caenorhabditis elegans


Alignment Length:251 Identity:83/251 - (33%)
Similarity:131/251 - (52%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL---GSERSAALEVDVSSAQS 69
            ||||:||.|..|||.|....|..:||.|:...||.|...|.::.|   |..:.|.:...::|...
 Worm    10 GKVAIVTAATKGIGLAIAERLLDEGASVVIGSRNQKNVDEAIEYLKNKGLTKVAGIAGHIASTDD 74

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGIT-RDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133
            .:..|...|:||.:. .|:||:.||. ..|::|::.::.:|.::.||:|..|.:|:.....:.::
 Worm    75 QKKLVDFTLQKFGKI-NILVNNHGINPAFGHILEVSDQVWDKLFEVNVKAGFQMTKLVHPHIAKE 138

  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAV 198
              ..|.|:..:|..|..:..|.|.|..||..::..|...:....|..||||.|.||.|.|.|..|
 Worm   139 --GGGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALAMGLAKDNIRVNGIAPGVIKTKMSQV 201

  Fly   199 VPD---SVKQEV--VQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
            :.|   ..::|:  :|...|||||.|::.|..:|:|||..|||:.|..|.:.||::
 Worm   202 LWDGGEDAEKELTDIQEIALGRLGVPDDCAGTVAYLASDDSSYITGEMIIIAGGVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 82/248 (33%)
BKR_SDR_c 9..248 CDD:187594 81/247 (33%)
dhrs-4NP_506230.1 SDR 9..260 CDD:330230 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.