DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and dhs-14

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503752.1 Gene:dhs-14 / 178738 WormBaseID:WBGene00000977 Length:279 Species:Caenorhabditis elegans


Alignment Length:270 Identity:89/270 - (32%)
Similarity:142/270 - (52%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL-----GSERSAALEVDVSS 66
            :||||||||:.:||||||..|||::||||....||....:||.||:     ..:...::..|:::
 Worm     5 SGKVALVTGSSNGIGRATAVLLAQEGAKVTITGRNADRLEETRQEILKSGVPEDHVLSIATDLAT 69

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGIT------RDGYLLKMPERD---YDDVYGVNLKGTFLV 122
            .:.....|...::||.:. .|:||:||..      |.|.     ::|   ||.:..:|::....:
 Worm    70 EKGQDELVNSTIQKFGRL-DILVNNAGAAFNDDQGRVGV-----DQDVSVYDRIMQINMRSVVTL 128

  Fly   123 TQAYAKAMIEQKLENGTIVNLSSIVAKMNNVGQAN-----YAATKAGVISFTEVASKEFGKFGIR 182
            ||...:.:::.|   |.:||:|||.|.    .||.     ||.:||.:..:|..|:.:..::|:|
 Worm   129 TQKAKEHLVKAK---GEVVNVSSIGAG----PQAQPTFMYYAMSKAALDQYTRSAAIDLIQYGVR 186

  Fly   183 VNCILPGYIDTPM--VAVVPDSVKQ------EVVQRC-PLGRLGQPEEIAEVIAFLASPQ-SSYV 237
            ||.:.||.:.|..  ...:|..:.:      |..:.| |.|::|||.:||.:|||||..: |||:
 Worm   187 VNSVSPGAVVTGFGEAMGMPADMHEKYGHFMESRKECIPCGKMGQPIDIANIIAFLADRKLSSYI 251

  Fly   238 NGAAIEVTGG 247
            .|.:|...||
 Worm   252 IGQSIVADGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 89/270 (33%)
BKR_SDR_c 9..248 CDD:187594 88/268 (33%)
dhs-14NP_503752.1 fabG 3..265 CDD:235975 89/270 (33%)
NADB_Rossmann 4..265 CDD:304358 89/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.