DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and dhs-13

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503501.1 Gene:dhs-13 / 178658 WormBaseID:WBGene00000976 Length:257 Species:Caenorhabditis elegans


Alignment Length:257 Identity:73/257 - (28%)
Similarity:119/257 - (46%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSV 70
            |..:|||||.:..|||.|..:.|...||.|:...|..:...|.|        |||.::...|...
 Worm     9 LTDRVALVTASTKGIGFAIAKQLGAAGASVVVCSRKKENVDEAV--------AALRLENIDAHGT 65

  Fly    71 QFSVAE----------ALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQA 125
            ...|..          .|.:|.:...:|.|:|.....|.|:|:.:..:|.:..:|:|..|.:|:.
 Worm    66 TAHVGNKSDRTKLIDFTLDRFTKLDILVSNAAVNPHYGDLMKVTDSQWDKLLDLNVKSAFELTKE 130

  Fly   126 YAKAMIEQKLENGTIVNLSSIV--AKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILP 188
            ....:  :....|.:|.:||:.  :.||.:|.  |:..|..:...::..:....:..||||.|.|
 Worm   131 AVPHL--EASGRGNVVFVSSVAGYSPMNEIGA--YSVMKTTLTGLSKSLALNLARRNIRVNSIAP 191

  Fly   189 GYIDTPMVAVV--PDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            |.|.|....|:  .:|.||:.:.:....|.|.|:|.||.:|||.|.::||::|..|.:.||:
 Worm   192 GIIQTDFSQVLFSDESEKQKWLSQIAQRRFGDPDECAEAVAFLVSDEASYISGETIGINGGM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 72/255 (28%)
BKR_SDR_c 9..248 CDD:187594 71/252 (28%)
dhs-13NP_503501.1 NADB_Rossmann 9..257 CDD:304358 73/257 (28%)
fabG 9..253 CDD:235975 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.