DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and dhs-11

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_499346.2 Gene:dhs-11 / 176485 WormBaseID:WBGene00000974 Length:244 Species:Caenorhabditis elegans


Alignment Length:247 Identity:113/247 - (45%)
Similarity:154/247 - (62%) Gaps:8/247 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQS 69
            :|:.|:|:|||.|||||:|.|:..|..||::|..|....||:.|...|.....:|.|:|||..:.
 Worm     1 MLSSKLAIVTGGGSGIGQAICKKFAASGARLIVADLKKSAAEATAGNLPGNGHSAFEIDVSDPEH 65

  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQK 134
            |. .:.|.:|...::|:::||.||||:|..||||.:..:.||..|||...||::|..|:    :.
 Worm    66 VA-RLQEFIKSSGESPSVLVNCAGITKDATLLKMSQNQWQDVMNVNLNSVFLMSQMIAR----ES 125

  Fly   135 LENG---TIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMV 196
            :..|   :|||:||||.|:.|.||.||||||:|||.||:.|::|.....||||.:|||:|.|||.
 Worm   126 VAAGSPLSIVNVSSIVGKIGNFGQTNYAATKSGVIGFTKSAARELATKNIRVNAVLPGFIRTPMT 190

  Fly   197 AVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            ..:|..|...:|...|..|||:.||||..:.||||..||||.|..:||||||
 Worm   191 EAMPPKVLDAMVSMVPQRRLGETEEIANAVLFLASDMSSYVTGTTLEVTGGL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 111/244 (45%)
BKR_SDR_c 9..248 CDD:187594 110/241 (46%)
dhs-11NP_499346.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 203 1.000 Domainoid score I1732
eggNOG 1 0.900 - - E2759_KOG1200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56588
Inparanoid 1 1.050 214 1.000 Inparanoid score I2344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm14129
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.