DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and R119.3

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_490726.1 Gene:R119.3 / 171628 WormBaseID:WBGene00020089 Length:253 Species:Caenorhabditis elegans


Alignment Length:250 Identity:70/250 - (28%)
Similarity:123/250 - (49%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALVTGAGSGIGRATCRLLARDGAKVIAV----DRNLKAAQETVQELGSERSAALEVDVSSAQSVQ 71
            |||.||.|.:|:|..|.||..|.||.|.    :...|.|::.::..|.  ..|..:||::|:..:
 Worm     4 ALVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGKVAEDNIKVGGD--VTAFSLDVANAEHRK 66

  Fly    72 FSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLE 136
            ..:.:..:|.....|:::........|.:::....|:|.::..||...|.::||....:  .|.:
 Worm    67 ELITKVAEKLGGLDTLIIVPPQNEVLGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTL--AKSQ 129

  Fly   137 NGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVPD 201
            ||:|:.|:|......::....|:...:.|:|.|:..::...|.|:|||.::.|.|:......|.|
 Worm   130 NGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGDGTGAVWD 194

  Fly   202 --------SVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
                    .:||.:....||||||:|.::|..:.||||.::.|:.|....|.||:
 Worm   195 HASGEEARQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 69/248 (28%)
BKR_SDR_c 9..248 CDD:187594 69/248 (28%)
R119.3NP_490726.1 fabG 4..249 CDD:235500 69/248 (28%)
SDR_c 4..241 CDD:212491 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.