DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and hsd17b14

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:257 Identity:68/257 - (26%)
Similarity:121/257 - (47%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVI--AVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQ 71
            :||::||...|||.|..:...:.||:|:  :.|...||.:..::..|......:..||:..:.::
 Frog    15 RVAVITGGTKGIGEAMVKEFVKSGARVVFCSKDTEAKALENEIKAAGPGDCIYVCCDVTKEEDIK 79

  Fly    72 FSVAEALKKFQQAPTIVVNSAG-----ITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131
            ..:...:..:.|...: :|:||     .|.||    ....|:.|:..:||.|.|| |..||...:
 Frog    80 KLIEITVMNYGQIDCL-INNAGWHPPEQTIDG----TSADDFRDLLNLNLIGYFL-TAKYALPHL 138

  Fly   132 EQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM- 195
            .:  ..|.|:|:||:|..:.......|.|||..|.:.|:..:.:..:..:|:|.|.||.|.||: 
 Frog   139 RK--TQGNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRHNVRINSISPGNIWTPLW 201

  Fly   196 ----------VAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
                      .|::...:..::     |||:|..||.|:...:||: :.::..|..:.:|||
 Frog   202 EELSSHSKNSEAMIQGGIDAQL-----LGRMGTAEECAKAALYLAA-EGTFCTGIDLLLTGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 68/257 (26%)
BKR_SDR_c 9..248 CDD:187594 68/257 (26%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.