DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and bdh2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002934803.2 Gene:bdh2 / 100485678 XenbaseID:XB-GENE-985755 Length:245 Species:Xenopus tropicalis


Alignment Length:253 Identity:80/253 - (31%)
Similarity:129/253 - (50%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV-DVSS 66
            :|.|.|||.:::.|..|||||.......:||:|||.|.|    :..::||.:.:.....| ||:.
 Frog     1 MGRLDGKVIVLSAAAQGIGRAAAIAFVNEGAQVIATDIN----ETKLKELEAYKGIQTRVLDVTK 61

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131
            ...:     |.|.|......::.|.||....|.:|...|.|:|....||::..:|:.:.:...|:
 Frog    62 KDQI-----EKLCKEIDRVDVLFNVAGFVHHGTILDCAEADWDFTMNVNVRSMYLMIKTFLPKML 121

  Fly   132 EQKLENGTIVNLSSIVAKMNN-VGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTP- 194
            .||  :|.|:|:||:.:.:.. |.:..|:.:||.||..|:..:.:|.:.|||.|||.||.:||| 
 Frog   122 AQK--SGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIEQGIRCNCICPGTVDTPS 184

  Fly   195 -----MVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
                 .....|:...::.:.|...||:...||:|.:..:|||.:|:||.|....:.||
 Frog   185 LRERIQARPDPEQAFKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIIDGG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 79/250 (32%)
BKR_SDR_c 9..248 CDD:187594 77/247 (31%)
bdh2XP_002934803.2 DHRS6_like_SDR_c 5..245 CDD:187626 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.