DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3592 and cyb561d1

DIOPT Version :9

Sequence 1:NP_570039.1 Gene:CG3592 / 31282 FlyBaseID:FBgn0029642 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001004590.1 Gene:cyb561d1 / 447851 ZFINID:ZDB-GENE-040912-157 Length:238 Species:Danio rerio


Alignment Length:210 Identity:49/210 - (23%)
Similarity:77/210 - (36%) Gaps:72/210 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FYEFAWPLLVAVFEVNLYRIILELLAHIL---LIVITVVMVKKTSGLDDHSSGQHALYAILGLFL 75
            |..|.|           .|.:..:.|||:   |:|:|.::.:..:.|    ...|.:...||..|
Zfish    25 FRIFVW-----------LRRLSVVAAHIVSLGLVVLTFILSRPGTSL----FSWHPVCMSLGFGL 74

  Fly    76 CVGESLLV--------C---HSW-----WLGDFISENRLNLLHMVLGMVGLWLGLVGIFAKSIFK 124
            |:.|.:|:        |   ..|     |.        ...|.::.|..|  ||.: :.:|:|  
Zfish    75 CMTEGILLFSAEGSPFCFKSRKWKVRLHWF--------FQALLLICGATG--LGFM-VASKNI-- 126

  Fly   125 SKIHEPHFNSKHGLCG-----------LLGFLLIAGAVASGFALVCFTHLALHVIHRLMGLCGFV 178
             |.|: ||.|.|...|           :.|.|||...:.|..:   |..|.|:  |...||..::
Zfish   127 -KEHQ-HFKSWHSYLGVSTMATTLLQAICGVLLIFPKLISTRS---FPRLRLY--HATCGLVAYL 184

  Fly   179 LLSC-------SQWF 186
            |.:.       :.||
Zfish   185 LATVTLMSAMFTDWF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3592NP_570039.1 Cyt_b561 65..189 CDD:176489 38/156 (24%)
cyb561d1NP_001004590.1 Cyt_b561_CYB561D2_like 41..221 CDD:176491 43/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.