DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32793 and YHR213W

DIOPT Version :9

Sequence 1:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_012083.1 Gene:YHR213W / 856620 SGDID:S000001256 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:41/150 - (27%)
Similarity:57/150 - (38%) Gaps:30/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AQEKSAQVAPQPHTVADFIIHPLIAFKPRQASLEEIQGKQA-------TPSSSAPASPGTWLFGM 127
            |.|..||..| |.|..||.|:   ..||.|.||.:..|...       .|.....::..:|  |.
Yeast    33 AFECCAQEQP-PITSTDFTIN---GIKPWQGSLPDNIGGTVYMYAGYYYPLKVVYSNAVSW--GT 91

  Fly   128 NPAQQLGSSFSTLAGSVSGW---FNDRLAAAGQQLP-------GLVETPVREST---TSTSTTTS 179
            .|........:|::....|:   |:|.|:.:...:|       .:|.|.....|   |||||..:
Yeast    92 LPISVELPDGTTVSDDFEGYVYSFDDDLSQSNCTIPDPSKHTTSIVTTTTELWTGTFTSTSTEMT 156

  Fly   180 TTT----QRPDIVVRVQQRP 195
            |.|    |..|..|.|.:.|
Yeast   157 TVTGTNGQPTDETVIVAKAP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990
YHR213WNP_012083.1 PA14 <1..110 CDD:415548 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.