DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32793 and FLO10

DIOPT Version :9

Sequence 1:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_013028.1 Gene:FLO10 / 853977 SGDID:S000001810 Length:1169 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:44/191 - (23%)
Similarity:70/191 - (36%) Gaps:30/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MAFGHMASVSAVTEAP--EVEQSTESPIAD----------MALIEDAPMAPKTPTEKPPIVQEAA 65
            ::|...::||..|.||  .||.:..:.|:.          .::....||.|...|.....|....
Yeast   634 VSFSLSSTVSEHTNAPTSSVESNASTFISSNKGSVKSYVTSSIHSITPMYPSNQTVTSSSVVSTP 698

  Fly    66 MVVDAQEKSAQVAPQPHTVADFIIHPLIAFKPRQASLEEIQGKQA---------TPSSSAPASPG 121
            :..::.|.||.|...|.|:..       .|||.....:.:....:         |.|..:.....
Yeast   699 ITSESSESSASVTILPSTITS-------EFKPSTMKTKVVSISSSPTNLITSYDTTSKDSTVGSS 756

  Fly   122 TWLFGMNPAQQLGSSFSTLAGSVSGWFNDRLAAAGQQLPGLVETPVRESTTSTSTTTSTTT 182
            |....:..:..|.||:|  |.|...:.:..:::.||.|.....|.|..|.:|.|..||.||
Yeast   757 TSSVSLISSISLPSSYS--ASSEQIFHSSIVSSNGQALTSFSSTKVSSSESSESHRTSPTT 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990
FLO10NP_013028.1 PA14 135..271 CDD:400161
Flocculin_t3 937..980 CDD:404761
Flocculin_t3 996..1037 CDD:404761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.