DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32793 and psd

DIOPT Version :9

Sequence 1:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster


Alignment Length:176 Identity:39/176 - (22%)
Similarity:63/176 - (35%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AFGHMASVSAVTEAP-EVEQSTESPIADMALIEDAPMAPKTPTEKPPIVQEAAMVVDAQEKSAQV 77
            |:...|..:...||| ....:.|:|..|.:    || ||..|..:||    |:.......:.||.
  Fly   214 AYEAPAPAAPAYEAPAPAAPAYEAPTTDYS----AP-APPAPAYEPP----ASSYTQGYSQPAQP 269

  Fly    78 APQPHTVADFIIHPLI------AFKPRQASLEEIQGKQATPSSSAPASPGTWLFG------MNPA 130
            :......|..:..|:|      |.|...:.:|....|..||::..|..|...::.      ..||
  Fly   270 SYVGAPPAQIVYQPIIYLSTPLASKSSTSQVEYDDQKYVTPTAPPPPPPPAPVYEAPSQNCYQPA 334

  Fly   131 QQLGSSFST-----------------LAGSVSGWFNDRLAAAGQQL 159
            .....:::|                 :|..:...:|.|||.|.|.:
  Fly   335 APPAPNYATPSCQTPIRLSLIDQPYRVAPELFEEYNYRLALASQNI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990
psdNP_001260116.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.