DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32793 and CG42676

DIOPT Version :9

Sequence 1:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001286905.1 Gene:CG42676 / 2768999 FlyBaseID:FBgn0261562 Length:427 Species:Drosophila melanogaster


Alignment Length:215 Identity:45/215 - (20%)
Similarity:81/215 - (37%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 PTRI-RPGTIVEKAPAMEAMEKPMEVNEMKQEQEVMATEPAASAPQTAANGSEQQEFIL------ 673
            ||.: :|..::|.||.......|.|..:.:.|.|....|.........::|:...|..|      
  Fly   116 PTNLCQPSNVLEAAPTPLMSLPPCEDEDHEPEHEHEHEESMKYRIDKESSGAASAELGLPAYEAC 180

  Fly   674 -----VGDDDEPGVSRHVQPAFGDARYVSYGDFHPYFDLLTQNRRFALRKTGRSLEIPEEQVAPK 733
                 ....||...|.|.||.           ..|.|.|.|            :|.:|....:..
  Fly   181 SPKMDYDTQDELPDSPHSQPL-----------PPPPFPLST------------ALPLPPPPTSHH 222

  Fly   734 GDLQKEEKPKEEE--QKEKLPKEEVQLEEIKKEEPQKEELQKEEPQKEEPQKEE----------- 785
            ..||::::.:.||  |:|.:.:::.|.::|::::.....||:::.|:::.|.::           
  Fly   223 QHLQQQQQQQHEERIQQEYIIQQQQQHQQIQQQQHHLALLQQQQQQEQQQQIQQHQGVNIAIGTT 287

  Fly   786 ------PRKEEPQKEEPQKE 799
                  .|||...|.  |||
  Fly   288 ATNNIRQRKERMSKR--QKE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990 11/50 (22%)
CG42676NP_001286905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.