DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32793 and EEED8.14

DIOPT Version :9

Sequence 1:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_495024.2 Gene:EEED8.14 / 184046 WormBaseID:WBGene00017142 Length:353 Species:Caenorhabditis elegans


Alignment Length:177 Identity:39/177 - (22%)
Similarity:72/177 - (40%) Gaps:30/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 QSLEQFEDDDSLELRPQQKP--KRKQTQVQTQNQRRKFQQEEQVISQKRRQSVTQNKKPKVQKKP 323
            |.|.| :.:..|::..|..|  .|........:::.:...|.|.| |:::..:.......:||:|
 Worm    13 QKLHQ-DTEKMLDMLYQDPPVDPRCTEHFSLLDRKVEIISEVQAI-QEKKIGLLNESLMNIQKQP 75

  Fly   324 V--QPVVEE--SQDEEELDDDENENDDEEEEEQVQEDD----SQEQDFQPEPIYGSS------SS 374
            .  :|...|  |..:.||.:..:|....|.|:::|:.:    ..:||...:.|...|      .|
 Worm    76 ATSEPSNAEFISNTKTELREMRSEIKYVESEQKLQDHELRLMRNDQDNDKKSIQALSVEVTELKS 140

  Fly   375 STRRSQNQPNFIQRGQ------------QSIISQIRQFTRGQTPGEL 409
            :.|.|:|:...||..:            :||..:|.:..:.|...||
 Worm   141 TQRDSENENESIQYQEFKIHKEEVLNDVKSIHGEIMEMKKKQNVSEL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990
EEED8.14NP_495024.2 Smc <41..230 CDD:224117 32/148 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.